PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000079.1_g00071.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 221aa    MW: 25687.2 Da    PI: 8.359
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000079.1_g00071.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR187.52e-2756144189
                     FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHn 86 
                              +fY++YA+++GF +r+++ ++s+ +++i +r++ C+k+g+  + k++   +r++r++tr gCka++ vk +k+gkw+vt++++eH+
  Itr_sc000079.1_g00071.1  56 EFYDNYARRAGFVMRIDQCRRSEVDKRILSRRLSCNKQGYYVKMKDQFGPARKPRTSTREGCKAMMLVKVDKSGKWVVTRFVKEHT 141
                              6*****************************************999999************************************** PP

                     FAR1  87 Hel 89 
                              H+l
  Itr_sc000079.1_g00071.1 142 HPL 144
                              *99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.6E-2556145IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MIKECEIHQC YVDIEVEAAI GDSSASAERR LDSGEESRVQ EPVVGMEFES EDAAKEFYDN  60
YARRAGFVMR IDQCRRSEVD KRILSRRLSC NKQGYYVKMK DQFGPARKPR TSTREGCKAM  120
MLVKVDKSGK WVVTRFVKEH THPLIVSGRP SRNAMDHKDR RIHELTMELD RQDRLCELYR  180
DQLNTLLKYI EEQIEVVSGK VQVVVSNVNQ VEKEARKPTN Q
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016455342.11e-103PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_016455343.11e-103PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A068U8P24e-95A0A068U8P2_COFCA; Uncharacterized protein
TrEMBLK4CTH72e-94K4CTH7_SOLLC; Uncharacterized protein
STRINGSolyc09g057880.2.14e-94(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA116022025
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.13e-67FAR1 family protein